PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009607191.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 291aa    MW: 33321.2 Da    PI: 6.4139
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009607191.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding476.1e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+ +++ +  g+W+ ++ + g  R++k+c++rw +yl
   XP_009607191.1 14 RGLWSPEEDEKLITYITTHSYGCWSEVPDKAGVQRCGKSCRLRWINYL 61
                     788*****************************99************97 PP

2Myb_DNA-binding56.75.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T++E++l++d+++  G++ W+ Ia++++ gRt++++k++w+++
   XP_009607191.1  67 RGRFTPDEEKLIIDLHAAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.234961IPR017930Myb domain
SuperFamilySSF466891.12E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-101363IPR001005SANT/Myb domain
PfamPF002494.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-231568IPR009057Homeodomain-like
CDDcd001674.91E-91761No hitNo description
PROSITE profilePS5129425.56262116IPR017930Myb domain
SMARTSM007173.4E-1766114IPR001005SANT/Myb domain
PfamPF002492.1E-1667111IPR001005SANT/Myb domain
CDDcd001671.42E-1269112No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2669117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGQHTCCNQQ KVKRGLWSPE EDEKLITYIT THSYGCWSEV PDKAGVQRCG KSCRLRWINY  60
LRPDIRRGRF TPDEEKLIID LHAAVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKLKKPS  120
PHSTKTTTSC DKNQSQFAYN ITNQQHQIFS SQDFGTKPQV LQESLCYSPN SFVFDTTSTS  180
SLFQDTLSLY SEFGQTHEQQ NHEAQTNSNY LPPLIESMDP QMGIPSACRT NNMLDVSGLM  240
GRNQLNEWGV ETQQFYPSYI IWDQETSPLI GDDLLAPTTS NIEELLSSFP S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607191.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A068UWQ01e-108A0A068UWQ0_COFCA; Uncharacterized protein
STRINGGLYMA08G02080.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA124391722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-75myb domain protein 103